Carbonic anhydrase X (CA10) (NM_001082534) Human Mass Spec Standard

SKU
PH312539
CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076003)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212539]
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC212539 protein sequence
Red=Cloning site Green=Tags(s)

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN
IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS
QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY
KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL
SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076003
RefSeq Size 2951
RefSeq ORF 984
Synonyms CA-RPX; CARPX; HUCEP-15
Locus ID 56934
UniProt ID Q9NS85
Cytogenetics 17q21.33-q22
Summary This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Carbonic anhydrase X (CA10) (NM_001082534) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309723 CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076002) 10 ug
$3,255.00
PH313425 CA10 MS Standard C13 and N15-labeled recombinant protein (NP_064563) 10 ug
$3,255.00
LC412601 CA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421186 CA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421187 CA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412601 Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 2 100 ug
$436.00
LY421186 Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1 100 ug
$436.00
LY421187 Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3 100 ug
$436.00
TP309723 Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312539 Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313425 Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720625 Purified recombinant protein of Human carbonic anhydrase X (CA10), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.