ZFYVE19 (NM_001077268) Human Mass Spec Standard

SKU
PH313044
ZFYVE19 MS Standard C13 and N15-labeled recombinant protein (NP_001070736)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213044]
Predicted MW 51.4 kDa
Protein Sequence
Protein Sequence
>RC213044 representing NM_001077268
Red=Cloning site Green=Tags(s)

MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLGRRDLSSADPA
VLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANA
SKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDER
QGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQ
NDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYR
LPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPW
CCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070736
RefSeq Size 2293
RefSeq ORF 1413
Synonyms ANCHR; MPFYVE
Locus ID 84936
UniProt ID Q96K21
Cytogenetics 15q15.1
Summary Key regulator of abscission step in cytokinesis: part of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage. Together with CHMP4C, required to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ZFYVE19/ANCHR and VPS4 and subsequent abscission.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZFYVE19 (NM_001077268) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421396 ZFYVE19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421396 Transient overexpression lysate of zinc finger, FYVE domain containing 19 (ZFYVE19) 100 ug
$665.00
TP313044 Recombinant protein of human zinc finger, FYVE domain containing 19 (ZFYVE19), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761556 Purified recombinant protein of Human zinc finger, FYVE domain containing 19 (ZFYVE19), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.