Amino terminal enhancer of split (AES) (NM_198970) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213043] |
Predicted MW | 21.7 kDa |
Protein Sequence |
Protein Sequence
>RC213043 representing NM_198970
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQLQAHQLSQLQALALP LTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_945321 |
RefSeq Size | 1684 |
RefSeq ORF | 588 |
Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
Locus ID | 166 |
UniProt ID | Q08117 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312475 | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) | 10 ug |
$3,255.00
|
|
LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 | 100 ug |
$436.00
|
|
LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 | 100 ug |
$436.00
|
|
TP312475 | Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP313043 | Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.