Amino terminal enhancer of split (AES) (NM_198970) Human Tagged ORF Clone

SKU
RC213043
AES (Myc-DDK-tagged)-Human amino-terminal enhancer of split (AES), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Amino terminal enhancer of split
Synonyms AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213043 representing NM_198970
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTTTCCACAAAGCAGGCATTCGGGCTCCTCGCACCTACCCCAGCAACTCAAATTCACCACCTCGG
ACTCCTGCGACCGCATCAAAGACGAATTTCAGCTACTGCAAGCTCAGTACCACAGCCTCAAGCTCGAATG
TGACAAGTTGGCCAGTGAGAAGTCAGAGATGCAGCGTCACTATGTGATGTACTACGAGATGTCCTACGGC
TTGAACATCGAGATGCACAAACAGGCTGAGATCGTCAAAAGGCTGAACGGGATTTGTGCCCAGGTCCTGC
CCTACCTCTCCCAAGAGCACCAGCAGCAGGTCTTGGGAGCCATTGAGAGGGCCAAGCAGGTCACCGCTCC
CGAGCTGAACTCTATCATCCGACAGCTCCAAGCCCACCAGCTGTCCCAGCTGCAGGCCCTGGCCCTGCCC
TTGACCCCACTACCCGTGGGGCTGCAGCCGCCTTCGCTGCCGGCGGTCAGCGCAGGCACCGGCCTCCTCT
CGCTGTCCGCGCTGGGTTCCCAGGCCCACCTCTCCAAGGAAGACAAGAACGGGCACGATGGTGACACCCA
CCAGGAGGATGATGGCGAGAAGTCGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213043 representing NM_198970
Red=Cloning site Green=Tags(s)

MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG
LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQLQAHQLSQLQALALP
LTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198970
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198970.2
RefSeq Size 1684 bp
RefSeq ORF 591 bp
Locus ID 166
UniProt ID Q08117
Cytogenetics 19p13.3
Protein Families Druggable Genome, Transcription Factors
MW 21.7 kDa
Summary The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Amino terminal enhancer of split (AES) (NM_198970) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213043L3 Lenti ORF clone of Human amino-terminal enhancer of split (AES), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC213043L4 Lenti ORF clone of Human amino-terminal enhancer of split (AES), transcript variant 3, mGFP tagged 10 ug
$600.00
RG213043 AES (tGFP-tagged) - Human amino-terminal enhancer of split (AES), transcript variant 3 10 ug
$500.00
SC307836 AES (untagged)-Human amino-terminal enhancer of split (AES), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.