NEURL2 (NM_080749) Human Mass Spec Standard

SKU
PH312983
NEURL2 MS Standard C13 and N15-labeled recombinant protein (NP_542787)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212983]
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC212983 protein sequence
Red=Cloning site Green=Tags(s)

MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVEI
EEKELGWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPT
LLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVLFCPRPDGTADMHIIING
EDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKD
FCKYE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542787
RefSeq Size 1440
RefSeq ORF 855
Synonyms C20orf163; OZZ; OZZ-E3
Locus ID 140825
UniProt ID Q9BR09
Cytogenetics 20q13.12
Summary This gene encodes a protein that is involved in the regulation of myofibril organization. This protein is likely the adaptor component of the E3 ubiquitin ligase complex in striated muscle, and it regulates the ubiquitin-mediated degradation of beta-catenin during myogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NEURL2 (NM_080749) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409066 NEURL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409066 Transient overexpression lysate of neuralized homolog 2 (Drosophila) (NEURL2) 100 ug
$436.00
TP312983 Purified recombinant protein of Homo sapiens neuralized homolog 2 (Drosophila) (NEURL2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.