Syntenin (SDCBP) (NM_001007067) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212681] |
Predicted MW | 32.4 kDa |
Protein Sequence |
Protein Sequence
>RC212681 protein sequence
Red=Cloning site Green=Tags(s) MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK RMAPSIMKSLMDHTIPEV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001007068 |
RefSeq Size | 2170 |
RefSeq ORF | 894 |
Synonyms | MDA-9; MDA9; ST1; SYCL; TACIP18 |
Locus ID | 6386 |
UniProt ID | O00560 |
Cytogenetics | 8q12.1 |
Summary | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315390 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_005616) | 10 ug |
$3,255.00
|
|
PH315442 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007069) | 10 ug |
$3,255.00
|
|
LC417182 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423571 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423572 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425198 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417182 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 1 | 100 ug |
$436.00
|
|
LY423571 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 | 100 ug |
$436.00
|
|
LY423572 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 3 | 100 ug |
$436.00
|
|
LY425198 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 | 100 ug |
$436.00
|
|
TP312681 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP315390 | Recombinant protein of human syndecan binding protein (syntenin) (SDCBP), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP315442 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP720983 | Purified recombinant protein of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 5 | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.