Syntenin (SDCBP) (NM_001007067) Human Tagged ORF Clone

SKU
RC212681
SDCBP (Myc-DDK-tagged)-Human syndecan binding protein (syntenin) (SDCBP), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Syntenin
Synonyms MDA-9; MDA9; ST1; SYCL; TACIP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212681 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTCTATCCATCTCTCGAAGACTTGAAGGTAGACAAAGTAATTCAGGCTCAAACTGCTTTTTCTG
CAAACCCTGCCAATCCAGCAATTTTGTCAGAAGCTTCTGCTCCTATCCCTCACGATGGAAATCTCTATCC
CAGACTGTATCCAGAGCTCTCTCAATACATGGGGCTGAGTTTAAATGAAGAAGAAATACGTGCAAATGTG
GCCGTGGTTTCTGGTGCACCACTTCAGGGGCAGTTGGTAGCAAGACCTTCCAGTATAAACTATATGGTGG
CTCCTGTAACTGGTAATGATGTTGGAATTCGTAGAGCAGAAATTAAGCAAGGGATTCGTGAAGTCATTTT
GTGTAAGGATCAAGATGGAAAAATTGGACTCAGGCTTAAATCAATAGATAATGGTATATTTGTTCAGCTA
GTCCAGGCTAATTCTCCAGCCTCATTGGTTGGTCTGAGATTTGGGGACCAAGTACTTCAGATCAATGGTG
AAAACTGTGCAGGATGGAGCTCTGATAAAGCGCACAAGGTGCTCAAACAGGCTTTTGGAGAGAAGATTAC
CATGACCATTCGTGACAGGCCCTTTGAACGGACGATTACCATGCATAAGGATAGCACTGGACATGTTGGT
TTTATCTTTAAAAATGGAAAAATAACATCCATAGTGAAAGATAGCTCTGCAGCCAGAAATGGTCTTCTCA
CGGAACATAACATCTGTGAAATCAATGGACAGAATGTCATTGGATTGAAGGACTCTCAAATTGCAGACAT
ACTGTCAACATCTGGGACTGTAGTTACTATTACAATCATGCCTGCTTTTATCTTTGAACATATTATTAAG
CGGATGGCACCAAGCATTATGAAAAGCCTAATGGACCACACCATTCCTGAGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212681 protein sequence
Red=Cloning site Green=Tags(s)

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV
AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL
VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK
RMAPSIMKSLMDHTIPEV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007067
ORF Size 894 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007067.1, NP_001007068.1
RefSeq Size 2170 bp
RefSeq ORF 897 bp
Locus ID 6386
UniProt ID O00560
Cytogenetics 8q12.1
Protein Families Druggable Genome, Transmembrane
MW 32.4 kDa
Summary The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:Syntenin (SDCBP) (NM_001007067) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212681L3 Lenti ORF clone of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC212681L4 Lenti ORF clone of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 2, mGFP tagged 10 ug
$600.00
RG212681 SDCBP (tGFP-tagged) - Human syndecan binding protein (syntenin) (SDCBP), transcript variant 2 10 ug
$500.00
SC301139 SDCBP (untagged)-Human syndecan binding protein (syntenin) (SDCBP), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.