OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL19 (NM_013371) Human Mass Spec Standard

Be the first to review this product
SKU
PH312571
IL19 MS Standard C13 and N15-labeled recombinant protein (NP_037503)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351285 Rabbit Polyclonal Anti-IL19 Antibody
100 ul
$205.00
LY415631 Transient overexpression lysate of interleukin 19 (IL19), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "IL19 or NM_013371"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212571
Predicted MW 20.45 kDa
Protein Sequence
Protein Sequence
>RC212571 representing NM_013371
Red=Cloning site Green=Tags(s)

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK
PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI
HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037503
RefSeq Size 1831
RefSeq ORF 531
Synonyms IL-10C; MDA1; NG.1; ZMDA1
Locus ID 29949
UniProt ID Q9UHD0
Cytogenetics 1q32.1
Summary The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL19" proteins (3)
SKU Description Size Price
LC415631 Lyophilized IL19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415631 Transient overexpression lysate of interleukin 19 (IL19), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312571 Recombinant protein of human interleukin 19 (IL19), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products