IKBKE (NM_014002) Human Mass Spec Standard

SKU
PH312481
IKBKE MS Standard C13 and N15-labeled recombinant protein (NP_054721)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212481]
Predicted MW 80.3 kDa
Protein Sequence
Protein Sequence
>RC212481 representing NM_014002
Red=Cloning site Green=Tags(s)

MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKL
FAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGN
IMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVT
LYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPI
LANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQ
EYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELK
AAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKS
RMRPGLGYNEEQIHKLDKVNFSHLDKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAA
CNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDN
NRIIERLNRVPAPPDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054721
RefSeq Size 3263
RefSeq ORF 2148
Synonyms IKK-E; IKK-i; IKKE; IKKI
Locus ID 9641
UniProt ID Q14164
Cytogenetics 1q32.1
Summary IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).[supplied by OMIM, Oct 2009]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IKBKE (NM_014002) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415533 IKBKE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415533 Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE) 100 ug
$665.00
TP312481 Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.