RFX5 (NM_001025603) Human Mass Spec Standard

SKU
PH312448
RFX5 MS Standard C13 and N15-labeled recombinant protein (NP_001020774)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212448]
Predicted MW 65.1 kDa
Protein Sequence
Protein Sequence
>RC212448 representing NM_001025603
Red=Cloning site Green=Tags(s)

MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS
GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR
EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD
WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK
PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI
LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG
GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM
ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL
VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020774
RefSeq Size 3611
RefSeq ORF 1848
Locus ID 5993
UniProt ID P48382
Cytogenetics 1q21.3
Summary A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation, Primary immunodeficiency
Write Your Own Review
You're reviewing:RFX5 (NM_001025603) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422455 RFX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424713 RFX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422455 Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2 100 ug
$665.00
LY424713 Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1 100 ug
$436.00
TP312448 Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761917 Purified recombinant protein of Human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1, Leu391-Pro616, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.