SOX6 (NM_033326) Human Mass Spec Standard

SKU
PH312046
SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_201583)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212046]
Predicted MW 89.7 kDa
Protein Sequence
Protein Sequence
>RC212046 representing NM_033326
Red=Cloning site Green=Tags(s)

MAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAA
QPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALFGD
QDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNEDGK
LGPGVIDLTRPEDAEGSKAMNGSARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNI
SKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEM
RQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTYGMKTDGGSLAG
NEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSANTRTRPLEQKLISEEDLAANDILDYKDDDDKV*

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_201583
RefSeq Size 8865
RefSeq ORF 2424
Synonyms HSSOX6; SOXD; TOLCAS
Locus ID 55553
UniProt ID P35712
Cytogenetics 11p15.2
Summary This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SOX6 (NM_033326) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311525 SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_059978) 10 ug
$3,255.00
LC403243 SOX6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403243 Transient overexpression lysate of SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2 100 ug
$665.00
TP311525 Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312046 Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.