Aspartate beta hydroxylase (ASPH) (NM_032466) Human Mass Spec Standard

SKU
PH311817
ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115855)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211817]
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC211817
Blue=ORF Red=Cloning site Green=Tag(s)

MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTS
VAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEA
EPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEE
TEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEI
TEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

myc-FLAG tag

Recombinant protein using RC211817 also available, TP311817
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115855
RefSeq Size 2680
RefSeq ORF 939
Synonyms AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin
Locus ID 444
UniProt ID Q12797
Cytogenetics 8q12.3
Summary This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:Aspartate beta hydroxylase (ASPH) (NM_032466) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316796 ASPH MS Standard C13 and N15-labeled recombinant protein (NP_004309) 10 ug
$3,255.00
PH323930 ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115857) 10 ug
$3,255.00
LC410099 ASPH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410101 ASPH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418063 ASPH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431238 ASPH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410099 Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 3 100 ug
$436.00
LY410101 Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2 100 ug
$436.00
LY418063 Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 1 100 ug
$665.00
LY431238 Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 8 100 ug
$436.00
TP311817 Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 3, 20 µg 20 ug
$867.00
TP316796 Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 1, 20 µg 20 ug
$737.00
TP323930 Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 2, 20 µg 20 ug
$737.00
TP328203 Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 11, 20 µg 20 ug
$737.00
TP328230 Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 10, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.