Aspartate beta hydroxylase (ASPH) (NM_032466) Human Recombinant Protein
SKU
TP311817
Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 3, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>Peptide sequence encoded by RC211817
Blue=ORF Red=Cloning site Green=Tag(s) MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTS VAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEA EPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEE TEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEI TEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT myc-FLAG tag Recombinant protein using RC211817 also available, TP311817 |
Tag | C-Myc/DDK |
Predicted MW | 34.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_115855 |
Locus ID | 444 |
UniProt ID | Q12797 |
Cytogenetics | 8q12.3 |
RefSeq Size | 2680 |
RefSeq ORF | 939 |
Synonyms | AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin |
Summary | This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH311817 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115855) | 10 ug |
$3,255.00
|
|
PH316796 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_004309) | 10 ug |
$3,255.00
|
|
PH323930 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115857) | 10 ug |
$3,255.00
|
|
LC410099 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410101 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418063 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC431238 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410099 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 3 | 100 ug |
$436.00
|
|
LY410101 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2 | 100 ug |
$436.00
|
|
LY418063 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 1 | 100 ug |
$665.00
|
|
LY431238 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 8 | 100 ug |
$436.00
|
|
TP316796 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP323930 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP328203 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 11, 20 µg | 20 ug |
$737.00
|
|
TP328230 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 10, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.