SIN1 (MAPKAP1) (NM_001006617) Human Mass Spec Standard

SKU
PH311745
MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211745]
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC211745 representing NM_001006617
Red=Cloning site Green=Tags(s)

MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV
DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS
ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI
CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF
VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC
LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001006618
RefSeq Size 3395
RefSeq ORF 1566
Synonyms JC310; MIP1; SIN1; SIN1b; SIN1g
Locus ID 79109
UniProt ID Q9BPZ7
Cytogenetics 9q33.3
Summary This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SIN1 (MAPKAP1) (NM_001006617) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400381 MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411350 MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423519 MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423693 MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400381 Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 6 100 ug
$436.00
LY411350 Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 2 100 ug
$436.00
LY423519 Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 5 100 ug
$436.00
LY423693 Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1 100 ug
$665.00
TP311745 Purified recombinant protein of Human mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.