SIN1 (MAPKAP1) (NM_001006617) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211745] |
Predicted MW | 58.9 kDa |
Protein Sequence |
Protein Sequence
>RC211745 representing NM_001006617
Red=Cloning site Green=Tags(s) MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001006618 |
RefSeq Size | 3395 |
RefSeq ORF | 1566 |
Synonyms | JC310; MIP1; SIN1; SIN1b; SIN1g |
Locus ID | 79109 |
UniProt ID | Q9BPZ7 |
Cytogenetics | 9q33.3 |
Summary | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400381 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411350 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423519 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423693 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400381 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 6 | 100 ug |
$436.00
|
|
LY411350 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY423519 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 5 | 100 ug |
$436.00
|
|
LY423693 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1 | 100 ug |
$665.00
|
|
TP311745 | Purified recombinant protein of Human mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.