Kv beta 2 (KCNAB2) (NM_003636) Human Mass Spec Standard

SKU
PH311690
KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_003627)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211690]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC211690 protein sequence
Red=Cloning site Green=Tags(s)

MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE
QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL
KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP
ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE
EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE
IDSILGNKPYSKKDYRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003627
RefSeq Size 4224
RefSeq ORF 1101
Synonyms AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2
Locus ID 8514
UniProt ID Q13303
Cytogenetics 1p36.31
Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2010]
Protein Families Druggable Genome, Ion Channels: Other
Write Your Own Review
You're reviewing:Kv beta 2 (KCNAB2) (NM_003636) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314602 KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_742128) 10 ug
$3,255.00
LC406850 KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418536 KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406850 Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2 100 ug
$436.00
LY418536 Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 100 ug
$436.00
TP311690 Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314602 Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.