Kv beta 2 (KCNAB2) (NM_003636) Human Tagged ORF Clone

SKU
RC211690
KCNAB2 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Kv beta 2
Synonyms AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211690 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATCCAGAATCAACGACGGGCTCCCCGGCTCGGCTCTCGCTGCGGCAGACGGGCTCCCCCGGGATGA
TCTACAGTACTCGGTATGGGAGTCCCAAAAGACAGCTCCAGTTTTACAGGAACCTGGGCAAGTCTGGCCT
GCGGGTCTCCTGCCTGGGACTTGGAACATGGGTGACCTTCGGAGGCCAGATCACCGATGAGATGGCAGAG
CAGCTCATGACCTTGGCCTATGATAATGGCATCAACCTCTTCGATACAGCAGAAGTCTACGCAGCCGGCA
AGGCTGAAGTGGTACTGGGAAACATCATTAAGAAGAAAGGATGGAGGCGGTCCAGCCTCGTCATCACCAC
CAAGATCTTCTGGGGCGGAAAGGCGGAGACGGAGCGGGGCCTGTCCAGGAAGCACATAATCGAAGGTCTG
AAAGCTTCCCTGGAGCGACTGCAGCTGGAGTACGTGGATGTGGTGTTTGCCAACCGCCCGGACCCCAACA
CCCCGATGGAAGAGACCGTCCGCGCCATGACCCACGTCATCAACCAGGGGATGGCCATGTACTGGGGCAC
GTCACGCTGGAGCTCCATGGAGATCATGGAGGCCTACTCCGTGGCCCGGCAGTTCAACCTGACCCCGCCC
ATCTGCGAGCAGGCTGAGTACCACATGTTCCAGCGTGAGAAAGTGGAGGTGCAGCTGCCGGAGCTGTTCC
ACAAGATAGGAGTGGGCGCCATGACCTGGTCCCCTCTGGCCTGTGGCATTGTTTCTGGCAAGTACGACAG
TGGCATCCCACCCTACTCAAGAGCCTCCTTGAAGGGCTACCAGTGGCTGAAGGACAAGATCCTCAGTGAG
GAGGGCCGGCGCCAGCAAGCCAAGCTGAAGGAGCTGCAGGCCATCGCCGAGCGCCTGGGCTGCACCCTGC
CCCAGCTGGCCATAGCCTGGTGCCTGAGGAATGAGGGAGTCAGCTCCGTGCTCCTGGGGGCCTCCAATGC
GGACCAGCTCATGGAGAACATTGGGGCAATACAGGTCCTTCCGAAACTGTCGTCTTCCATTATCCACGAG
ATTGATAGTATTTTGGGCAATAAACCCTACAGCAAAAAGGACTACAGATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211690 protein sequence
Red=Cloning site Green=Tags(s)

MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE
QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL
KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP
ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE
EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE
IDSILGNKPYSKKDYRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003636
ORF Size 1101 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003636.1
RefSeq Size 4224 bp
RefSeq ORF 1104 bp
Locus ID 8514
UniProt ID Q13303
Cytogenetics 1p36.31
Domains aldo_ket_red
Protein Families Druggable Genome, Ion Channels: Other
MW 41 kDa
Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:Kv beta 2 (KCNAB2) (NM_003636) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211690L1 Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC211690L2 Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC211690L3 Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC211690L4 Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG211690 KCNAB2 (tGFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC310485 KCNAB2 (untagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.