OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPANXA1 (NM_013453) Human Mass Spec Standard

Be the first to review this product
SKU
PH311653
SPANXA1 MS Standard C13 and N15-labeled recombinant protein (NP_038481)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415587 Transient overexpression lysate of sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) (as WB positive control) 100 ug
$436.00

Other products for "SPANXA1 or NM_013453"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211653
Predicted MW 11 kDa
Protein Sequence
Protein Sequence
>RC211653 protein sequence
Red=Cloning site Green=Tags(s)

MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND
HARENRINPLQMEEEEFMEIMVEIPAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_038481
RefSeq Size 418
RefSeq ORF 291
Synonyms CT11.1; CT11.3; NAP-X; SPAN-X; SPAN-Xa; SPAN-Xb; SPANX; SPANX-A
Locus ID 30014
UniProt ID Q9NS26
Cytogenetics Xq27.2
Summary Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPANXA1" proteins (3)
SKU Description Size Price
LC415587 Lyophilized SPANXA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415587 Transient overexpression lysate of sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) (as WB positive control) 100 ug
$436.00
TP311653 Recombinant protein of human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products