SPANXA1 (NM_013453) Human Tagged ORF Clone

SKU
RC211653
SPANXA1 (Myc-DDK-tagged)-Human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPANXA1
Synonyms CT11.1; CT11.3; NAP-X; SPAN-X; SPAN-Xa; SPAN-Xb; SPANX; SPANX-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211653 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAAACAATCCAGTGCCGGCGGGGTGAAGAGGAGCGTCCCCTGTGATTCCAACGAGGCCAACGAGA
TGATGCCGGAGACCCCAACTGGGGACTCAGACCCGCAACCTGCTCCTAAAAAAATGAAAACATCTGAGTC
CTCGACCATACTAGTGGTTCGCTACAGGAGGAACTTTAAAAGAACATCTCCAGAGGAACTGCTGAATGAC
CACGCCCGAGAGAACAGAATCAACCCCCTCCAAATGGAGGAGGAGGAATTCATGGAAATAATGGTTGAAA
TACCTGCAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211653 protein sequence
Red=Cloning site Green=Tags(s)

MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND
HARENRINPLQMEEEEFMEIMVEIPAK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013453
ORF Size 291 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013453.3
RefSeq Size 418 bp
RefSeq ORF 294 bp
Locus ID 30014
UniProt ID Q9NS26
Cytogenetics Xq27.2
MW 11 kDa
Summary Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SPANXA1 (NM_013453) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211653L3 Lenti ORF clone of Human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1), Myc-DDK-tagged 10 ug
$450.00
RC211653L4 Lenti ORF clone of Human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1), mGFP tagged 10 ug
$450.00
RG211653 SPANXA1 (tGFP-tagged) - Human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) 10 ug
$489.00
SC304011 SPANXA1 (untagged)-Human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.