hnRNP A1 (HNRNPA1) (NM_031157) Human Mass Spec Standard

SKU
PH311626
HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_112420)
In Control Promo
  $3,360.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211626
Predicted MW 38.6 kDa
Protein Sequence
Protein Sequence
>RC211626 representing NM_031157
Red=Cloning site Green=Tags(s)

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA
AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR
GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF
GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG
YGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
PRNQGGYGGFSSSSSYGSGRRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112420
RefSeq Size 1925
RefSeq ORF 1116
Synonyms ALS19; ALS20; hnRNP-A1; hnRNP A1; HNRPA1; HNRPA1L3; IBMPFD3; UP 1
Locus ID 3178
UniProt ID P09651
Cytogenetics 12q13.13
Summary This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. provided by RefSeq, Feb 2016
Protein Pathways Spliceosome
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "hnRNP A1" proteins (7)
SKU Description Size Price
PH303314 HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_002127) 10 ug
$3,360.00
LC400778 HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410582 HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400778 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1 100 ug
$436.00
LY410582 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2 100 ug
$436.00
TP303314 Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1, 20 µg 20 ug
$867.00
TP311626 Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2, 20 µg 20 ug
$737.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.