hnRNP A1 (HNRNPA1) (NM_002136) Human Recombinant Protein
SKU
TP303314
Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203314 protein sequence
Red=Cloning site Green=Tags(s) MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN FGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Binding assay (PMID: 29762696) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002127 |
Locus ID | 3178 |
UniProt ID | P09651 |
Cytogenetics | 12q13.13 |
RefSeq Size | 1785 |
RefSeq ORF | 960 |
Synonyms | ALS19; ALS20; hnRNP-A1; hnRNP A1; HNRPA1; HNRPA1L3; IBMPFD3; UP 1 |
Summary | This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016] |
Protein Pathways | Spliceosome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303314 | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_002127) | 10 ug |
$3,255.00
|
|
PH311626 | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_112420) | 10 ug |
$3,255.00
|
|
LC400778 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410582 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400778 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1 | 100 ug |
$436.00
|
|
LY410582 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2 | 100 ug |
$436.00
|
|
TP311626 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.