KCNIP4 (NM_147183) Human Mass Spec Standard

SKU
PH311613
KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211613]
Predicted MW 26.3 kDa
Protein Sequence
Protein Sequence
>RC211613 representing NM_147183
Red=Cloning site Green=Tags(s)

MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILY
RGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKL
NWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIE
SCQKDENIMRSMQLFENVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_671712
RefSeq Size 1373
RefSeq ORF 687
Synonyms CALP; KCHIP4
Locus ID 80333
UniProt ID Q6PIL6
Cytogenetics 4p15.31-p15.2
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Other
Write Your Own Review
You're reviewing:KCNIP4 (NM_147183) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307464 KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_001030176) 10 ug
$3,255.00
PH311488 KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_079497) 10 ug
$3,255.00
LC407777 KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407778 KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410769 KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422121 KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407777 Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 3 100 ug
$436.00
LY407778 Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 4 100 ug
$436.00
LY410769 Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 1 100 ug
$436.00
LY422121 Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 6 100 ug
$436.00
TP307464 Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311488 Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311613 Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762665 Purified recombinant protein of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3, full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.