KCNIP4 (NM_001035004) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207464] |
Predicted MW | 28.7 kDa |
Protein Sequence |
Protein Sequence
>RC207464 protein sequence
Red=Cloning site Green=Tags(s) MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001030176 |
RefSeq Size | 2345 |
RefSeq ORF | 750 |
Synonyms | CALP; KCHIP4 |
Locus ID | 80333 |
UniProt ID | Q6PIL6 |
Cytogenetics | 4p15.31-p15.2 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH311488 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_079497) | 10 ug |
$3,255.00
|
|
PH311613 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712) | 10 ug |
$3,255.00
|
|
LC407777 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407778 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410769 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422121 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407777 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 3 | 100 ug |
$436.00
|
|
LY407778 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 4 | 100 ug |
$436.00
|
|
LY410769 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 1 | 100 ug |
$436.00
|
|
LY422121 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 6 | 100 ug |
$436.00
|
|
TP307464 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP311488 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP311613 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP762665 | Purified recombinant protein of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3, full length, with N-GST and C-His tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.