AZI2 (NM_022461) Human Mass Spec Standard

SKU
PH311435
AZI2 MS Standard C13 and N15-labeled recombinant protein (NP_071906)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211435]
Predicted MW 44.8 kDa
Protein Sequence
Protein Sequence
>RC211435 representing NM_022461
Red=Cloning site Green=Tags(s)

MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLE
EKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRT
EVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQ
KLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTA
TYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV
FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071906
RefSeq Size 3113
RefSeq ORF 1176
Synonyms AZ2; NAP1; TILP
Locus ID 64343
UniProt ID Q9H6S1
Cytogenetics 3p24.1
Summary AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).[supplied by OMIM, Mar 2008]
Protein Pathways RIG-I-like receptor signaling pathway
Write Your Own Review
You're reviewing:AZI2 (NM_022461) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411676 AZI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411676 Transient overexpression lysate of 5-azacytidine induced 2 (AZI2), transcript variant 1 100 ug
$436.00
TP311435 Recombinant protein of human 5-azacytidine induced 2 (AZI2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.