OTOS (NM_148961) Human Mass Spec Standard

SKU PH311259

OTOS MS Standard C13 and N15-labeled recombinant protein (NP_683764)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC211259]
• Predicted MW: 9.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC211259 protein sequence; Red=Cloning site Green=Tags(s); ; MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF; FAHFPLGSTLGFHVPYQED; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_683764
• RefSeq Size: 566
• RefSeq ORF: 267
• Synonyms: OTOSP
• Locus ID: 150677
• UniProt ID: Q8NHW6
• Cytogenetics: 2q37.3
• Summary: Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008]
• Protein Families: Secreted Protein