PODXL (NM_005397) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210816] |
Predicted MW | 55.4 kDa |
Protein Sequence |
Protein Sequence
>RC210816 protein sequence
Red=Cloning site Green=Tags(s) MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM KISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPE TMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICR AVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPE EAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEM QEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005388 |
RefSeq Size | 5911 |
RefSeq ORF | 1578 |
Synonyms | gp135; Gp200; PC; PCLP; PCLP-1; PDX; PODXL1 |
Locus ID | 5420 |
UniProt ID | O00592 |
Cytogenetics | 7q32.3 |
Summary | This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401657 | PODXL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401657 | Transient overexpression lysate of podocalyxin-like (PODXL), transcript variant 2 | 100 ug |
$436.00
|
|
TP310816 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP700181 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Ser23-Pro461, expressed in HEK293 cells. | 20 ug |
$867.00
|
|
TP700182 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Gln32-Pro461, expressed in HEK293 cells. | 20 ug |
$867.00
|
|
TP762498 | Purified recombinant protein of Human podocalyxin-like (PODXL), transcript variant 1, 273Ser-459Ser, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.