PODXL (NM_005397) Human Mass Spec Standard

SKU
PH310816
PODXL MS Standard C13 and N15-labeled recombinant protein (NP_005388)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210816]
Predicted MW 55.4 kDa
Protein Sequence
Protein Sequence
>RC210816 protein sequence
Red=Cloning site Green=Tags(s)

MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK
ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT
AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM
KISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPE
TMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICR
AVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPE
EAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEM
QEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005388
RefSeq Size 5911
RefSeq ORF 1578
Synonyms gp135; Gp200; PC; PCLP; PCLP-1; PDX; PODXL1
Locus ID 5420
UniProt ID O00592
Cytogenetics 7q32.3
Summary This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PODXL (NM_005397) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401657 PODXL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401657 Transient overexpression lysate of podocalyxin-like (PODXL), transcript variant 2 100 ug
$436.00
TP310816 Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, 20 µg 20 ug
$737.00
TP700181 Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Ser23-Pro461, expressed in HEK293 cells. 20 ug
$867.00
TP700182 Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Gln32-Pro461, expressed in HEK293 cells. 20 ug
$867.00
TP762498 Purified recombinant protein of Human podocalyxin-like (PODXL), transcript variant 1, 273Ser-459Ser, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.