LECT2 (NM_002302) Human Mass Spec Standard

SKU PH310790

LECT2 MS Standard C13 and N15-labeled recombinant protein (NP_002293)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210790]
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210790 protein sequence; Red=Cloning site Green=Tags(s); ; MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF; TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE; NCDSSDPTAYL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002293
• RefSeq Size: 1077
• RefSeq ORF: 453
• Synonyms: chm-II; chm2
• Locus ID: 3950
• UniProt ID: O14960
• Cytogenetics: 5q31.1
• Summary: This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein