OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALY (NM_016732) Human Mass Spec Standard

Be the first to review this product
SKU
PH310723
RALY MS Standard C13 and N15-labeled recombinant protein (NP_057951)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331901 Rabbit Polyclonal Anti-RALY Antibody
100 ul
$525.00
LY413828 Transient overexpression lysate of RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RALY or NM_016732"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210723
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC210723 protein sequence
Red=Cloning site Green=Tags(s)

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ
IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG
DEEGLLTHSEEELEHSQDTDADDGALQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057951
RefSeq Size 4790
RefSeq ORF 921
Synonyms HNRPCL2; P542
Locus ID 22913
UniProt ID Q9UKM9
Cytogenetics 20q11.22
Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALY" proteins (5)
SKU Description Size Price
PH323333 RALY MS Standard C13 and N15-labeled recombinant protein (NP_031393) 10 ug
$3,360.00
LC413828 Lyophilized RALY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413828 Transient overexpression lysate of RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310723 Recombinant protein of human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1, 20 µg 20 ug
$867.00
TP323333 Recombinant protein of human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products