RBM35A (ESRP1) (NM_001034915) Human Mass Spec Standard

SKU
PH310539
ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001030087)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210539]
Predicted MW 75.1 kDa
Protein Sequence
Protein Sequence
>RC210539 protein sequence
Red=Cloning site Green=Tags(s)

MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI
DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR
KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD
LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC
PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD
AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCLSPPSYTFPAPAA
VIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQPGTV
VRMQGLAYNTGVKEILNFSQGYQYATEDGLIHTNDQARTLPKEWVCI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001030087
RefSeq Size 3794
RefSeq ORF 2031
Synonyms DFNB109; RBM35A; RMB35A
Locus ID 54845
UniProt ID Q6NXG1
Cytogenetics 8q22.1
Summary ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009]
Write Your Own Review
You're reviewing:RBM35A (ESRP1) (NM_001034915) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309131 ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_060167) 10 ug
$3,255.00
LC413607 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422113 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426568 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426569 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413607 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1 100 ug
$436.00
LY422113 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2 100 ug
$436.00
LY426568 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 3 100 ug
$436.00
LY426569 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 5 100 ug
$436.00
TP309131 Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310539 Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.