RBM35A (ESRP1) (NM_017697) Human Recombinant Protein

SKU
TP309131
Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209131 protein sequence
Red=Cloning site Green=Tags(s)

MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI
DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR
KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD
LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC
PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD
AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLPCLSPPSYTFP
APAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQ
PGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGLIHTNDQARTLPKEWVCI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 75.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060167
Locus ID 54845
UniProt ID Q6NXG1
Cytogenetics 8q22.1
RefSeq Size 3806
RefSeq ORF 2043
Synonyms DFNB109; RBM35A; RMB35A
Summary ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009]
Write Your Own Review
You're reviewing:RBM35A (ESRP1) (NM_017697) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309131 ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_060167) 10 ug
$3,255.00
PH310539 ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001030087) 10 ug
$3,255.00
LC413607 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422113 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426568 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426569 ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413607 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1 100 ug
$436.00
LY422113 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2 100 ug
$436.00
LY426568 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 3 100 ug
$436.00
LY426569 Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 5 100 ug
$436.00
TP310539 Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.