CD226 (NM_006566) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210437] |
Predicted MW | 38.6 kDa |
Protein Sequence |
Protein Sequence
>RC210437 protein sequence
Red=Cloning site Green=Tags(s) MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR RERRDLFTESWDTQKAPNNYRSPISTGQPTNQSMDDTREDIYVNYPTFSRRPKTRV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006557 |
RefSeq Size | 2664 |
RefSeq ORF | 1008 |
Synonyms | DNAM-1; DNAM1; PTA1; TLiSA1 |
Locus ID | 10666 |
UniProt ID | Q15762 |
Cytogenetics | 18q22.2 |
Summary | This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC416555 | CD226 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416555 | Transient overexpression lysate of CD226 molecule (CD226) | 100 ug |
$436.00
|
|
TP310437 | Recombinant protein of human CD226 molecule (CD226), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP701017 | Purified recombinant protein of Human CD226 molecule (CD226), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug | 50 ug |
$867.00
|
|
TP723967 | Human DNAM-1 Protein, mFc-His Tag | 100 ug |
$650.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.