CD226 (NM_006566) Human Mass Spec Standard

SKU
PH310437
CD226 MS Standard C13 and N15-labeled recombinant protein (NP_006557)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210437]
Predicted MW 38.6 kDa
Protein Sequence
Protein Sequence
>RC210437 protein sequence
Red=Cloning site Green=Tags(s)

MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV
IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI
VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP
DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR
RERRDLFTESWDTQKAPNNYRSPISTGQPTNQSMDDTREDIYVNYPTFSRRPKTRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006557
RefSeq Size 2664
RefSeq ORF 1008
Synonyms DNAM-1; DNAM1; PTA1; TLiSA1
Locus ID 10666
UniProt ID Q15762
Cytogenetics 18q22.2
Summary This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:CD226 (NM_006566) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416555 CD226 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416555 Transient overexpression lysate of CD226 molecule (CD226) 100 ug
$436.00
TP310437 Recombinant protein of human CD226 molecule (CD226), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701017 Purified recombinant protein of Human CD226 molecule (CD226), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00
TP723967 Human DNAM-1 Protein, mFc-His Tag 100 ug
$650.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.