FNTA (NM_002027) Human Mass Spec Standard

SKU
PH310293
FNTA MS Standard C13 and N15-labeled recombinant protein (NP_002018)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210293]
Predicted MW 44.4 kDa
Protein Sequence
Protein Sequence
>RC210293 protein sequence
Red=Cloning site Green=Tags(s)

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA
EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL
LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI
QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL
KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT
IRKEYWRYIGRSLQSKHSTENDSPTNVQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002018
RefSeq Size 1710
RefSeq ORF 1137
Synonyms FPTA; PGGT1A; PTAR2
Locus ID 2339
UniProt ID P49354
Cytogenetics 8p11.21
Summary Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, May 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:FNTA (NM_002027) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419578 FNTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419578 Transient overexpression lysate of farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1 100 ug
$436.00
TP310293 Purified recombinant protein of Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.