CA8 (NM_004056) Human Mass Spec Standard

SKU
PH310228
CA8 MS Standard C13 and N15-labeled recombinant protein (NP_004047)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210228]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC210228 protein sequence
Red=Cloning site Green=Tags(s)

MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL
SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL
HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP
LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL
SDRVIRAAFQ

TRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004047
RefSeq Size 2278
RefSeq ORF 870
Synonyms CA-RP; CA-VIII; CALS; CAMRQ3; CARP
Locus ID 767
UniProt ID P35219
Cytogenetics 8q12.1
Summary The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Write Your Own Review
You're reviewing:CA8 (NM_004056) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418248 CA8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418248 Transient overexpression lysate of carbonic anhydrase VIII (CA8) 100 ug
$436.00
TP310228 Recombinant protein of human carbonic anhydrase VIII (CA8), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720093 Purified recombinant protein of Homo sapiens carbonic anhydrase VIII (CA8) 10 ug
$200.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.