alpha 5 Defensin (DEFA5) (NM_021010) Human Mass Spec Standard

SKU PH310219

DEFA5 MS Standard C13 and N15-labeled recombinant protein (NP_066290)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210219]
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC210219 protein sequence; Red=Cloning site Green=Tags(s); ; MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG; RCATRESLSGVCEISGRLYRLCCR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_066290
• RefSeq Size: 468
• RefSeq ORF: 282
• Synonyms: DEF5; HD-5
• Locus ID: 1670
• UniProt ID: Q01523
• Cytogenetics: 8p23.1
• Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein