alpha 5 Defensin (DEFA5) (NM_021010) Human Tagged ORF Clone

SKU
RC210219
DEFA5 (Myc-DDK-tagged)-Human defensin, alpha 5, Paneth cell-specific (DEFA5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol alpha 5 Defensin
Synonyms DEF5; HD-5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210219 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCATCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGTCACTCCAGG
AAAGAGCTGATGAGGCTACAACCCAGAAGCAGTCTGGGGAAGACAACCAGGACCTTGCTATCTCCTTTGC
AGGAAATGGACTCTCTGCTCTTAGAACCTCAGGTTCTCAGGCAAGAGCCACCTGCTATTGCCGAACTGGC
CGTTGTGCTACCCGTGAGTCCCTCTCCGGGGTGTGTGAAATCAGTGGCCGCCTCTACAGACTCTGCTGTC
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210219 protein sequence
Red=Cloning site Green=Tags(s)

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG
RCATRESLSGVCEISGRLYRLCCR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021010
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021010.3
RefSeq Size 468 bp
RefSeq ORF 285 bp
Locus ID 1670
UniProt ID Q01523
Cytogenetics 8p23.1
Protein Families Secreted Protein
MW 10.1 kDa
Summary Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:alpha 5 Defensin (DEFA5) (NM_021010) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210219L1 Lenti ORF clone of Human defensin, alpha 5, Paneth cell-specific (DEFA5), Myc-DDK-tagged 10 ug
$450.00
RC210219L2 Lenti ORF clone of Human defensin, alpha 5, Paneth cell-specific (DEFA5), mGFP tagged 10 ug
$450.00
RC210219L3 Lenti ORF clone of Human defensin, alpha 5, Paneth cell-specific (DEFA5), Myc-DDK-tagged 10 ug
$450.00
RC210219L4 Lenti ORF clone of Human defensin, alpha 5, Paneth cell-specific (DEFA5), mGFP tagged 10 ug
$450.00
RG210219 DEFA5 (tGFP-tagged) - Human defensin, alpha 5, Paneth cell-specific (DEFA5) 10 ug
$489.00
SC304891 DEFA5 (untagged)-Human defensin, alpha 5, Paneth cell-specific (DEFA5) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.