RHEX (NM_001007544) Human Mass Spec Standard

SKU
PH310024
C1orf186 MS Standard C13 and N15-labeled recombinant protein (NP_001007545)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210024]
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC210024 representing NM_001007544
Red=Cloning site Green=Tags(s)

MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHHHPPAVKEMKE
TQTERDIPMSDSLYRHDSDTPSDSLDSSCSSPPACQATEDVDYTQVVFSDPGELKNDSPLDYENIKEITD
YVNVNPERHKPSFWYFVNPALSEPAEYDQVAM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007545
RefSeq Size 1665
RefSeq ORF 516
Synonyms C1orf186
Locus ID 440712
UniProt ID Q6ZWK4
Cytogenetics 1q32.1
Summary Acts as a signaling transduction factor of the EPO-EPOR signaling pathway promoting erythroid cell differentiation (PubMed:25092874).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:RHEX (NM_001007544) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423507 C1orf186 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423507 Transient overexpression lysate of chromosome 1 open reading frame 186 (C1orf186) 100 ug
$436.00
TP310024 Recombinant protein of human chromosome 1 open reading frame 186 (C1orf186), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.