PTP4A2 (NM_080391) Human Mass Spec Standard

SKU PH309983

PTP4A2 MS Standard C13 and N15-labeled recombinant protein (NP_536316)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC209983]
• Predicted MW: 19.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC209983 protein sequence; Red=Cloning site Green=Tags(s); ; MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG; APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS; KQLLYLEKYRPKMRLRFRDTNGHCCVQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_536316
• RefSeq Size: 3939
• RefSeq ORF: 501
• Synonyms: HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2
• Locus ID: 8073
• UniProt ID: Q12974
• Cytogenetics: 1p35.2
• Summary: The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010]
• Protein Families: Druggable Genome, Phosphatase