OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTP4A2 (NM_080391) Human Mass Spec Standard

Be the first to review this product
SKU
PH309983
PTP4A2 MS Standard C13 and N15-labeled recombinant protein (NP_536316)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324079 Anti-PTP4A2 rabbit polyclonal antibody
100 ul
$305.00
LY409184 Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PTP4A2 or NM_080391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209983
Predicted MW 19.1 kDa
Protein Sequence
Protein Sequence
>RC209983 protein sequence
Red=Cloning site Green=Tags(s)

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS
KQLLYLEKYRPKMRLRFRDTNGHCCVQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_536316
RefSeq Size 3939
RefSeq ORF 501
Synonyms HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2
Locus ID 8073
UniProt ID Q12974
Cytogenetics 1p35.2
Summary The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. provided by RefSeq, Aug 2010
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTP4A2" proteins (3)
SKU Description Size Price
LC409184 Lyophilized PTP4A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409184 Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP309983 Recombinant protein of human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products