OTUB2 (NM_023112) Human Mass Spec Standard

SKU
PH309650
OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209650]
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC209650 protein sequence
Red=Cloning site Green=Tags(s)

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE
AATPSVYLLYKTSHYNILYAADKH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_075601
RefSeq Size 3873
RefSeq ORF 702
Synonyms C14orf137; OTB2; OTU2
Locus ID 78990
UniProt ID Q96DC9
Cytogenetics 14q32.12
Summary This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011]
Protein Families Protease
Write Your Own Review
You're reviewing:OTUB2 (NM_023112) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402958 OTUB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402958 Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) 100 ug
$436.00
TP309650 Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720215 Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.