OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MCCC2 (NM_022132) Human Mass Spec Standard

Be the first to review this product
SKU
PH309488
MCCC2 MS Standard C13 and N15-labeled recombinant protein (NP_071415)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339356 Rabbit Polyclonal Anti-MCCC2 Antibody
100 ul
$585.00
LY411752 Transient overexpression lysate of methylcrotonoyl-Coenzyme A carboxylase 2 (beta) (MCCC2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "MCCC2 or NM_022132"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209488
Predicted MW 61.3 kDa
Protein Sequence
Protein Sequence
>RC209488 protein sequence
Red=Cloning site Green=Tags(s)

MWAVLRLALRPCARASPAGPRAYHGDSVASLGTQPDLGSALYQENYKQMKALVNQLHERVEHIKLGGGEK
ARALHISRGKLLPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGIITGIGRVSGVECMIIANDATV
KGGAYYPVTVKKQLRAQEIAMQNRLPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIA
VVMGSCTAGGAYVPAMADENIIVRKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRKSGVSDHWALDD
HHALHLTRKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAF
YGDTLVTGFARIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAK
DGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQR
AREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGI
FRM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071415
RefSeq Size 3696
RefSeq ORF 1689
Synonyms MCCB; MCCCbeta
Locus ID 64087
UniProt ID Q9HCC0
Cytogenetics 5q13.2
Summary This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, May 2018
Protein Families Druggable Genome
Protein Pathways leucine and isoleucine degradation, Metabolic pathways, Valine
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MCCC2" proteins (3)
SKU Description Size Price
LC411752 Lyophilized MCCC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411752 Transient overexpression lysate of methylcrotonoyl-Coenzyme A carboxylase 2 (beta) (MCCC2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP309488 Recombinant protein of human methylcrotonoyl-Coenzyme A carboxylase 2 (beta) (MCCC2), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products