KLHL13 (NM_033495) Human Mass Spec Standard

SKU
PH309484
KLHL13 MS Standard C13 and N15-labeled recombinant protein (NP_277030)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209484]
Predicted MW 73.9 kDa
Protein Sequence
Protein Sequence
>RC209484 protein sequence
Red=Cloning site Green=Tags(s)

MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQSSKAGPTRIFT
SNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGV
SKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVTLDNCVEVGRIANTYNLTE
VDKYVNSFVLKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMK
NIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLR
QQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYGHAGTVYGGVM
YISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYY
SPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIR
ACTLTVFPPEETTPSPSRESPLSAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_277030
RefSeq Size 3991
RefSeq ORF 1965
Synonyms BKLHD2
Locus ID 90293
UniProt ID Q9P2N7
Cytogenetics Xq24
Summary This gene encodes a BTB and kelch domain containing protein and belongs to the kelch repeat domain containing superfamily of proteins. The encoded protein functions as an adaptor protein that complexes with Cullin 3 and other proteins to form the Cullin 3-based E3 ubiquitin-protein ligase complex. This complex is necessary for proper chromosome segregation and completion of cytokinesis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:KLHL13 (NM_033495) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409529 KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433380 KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433401 KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409529 Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 1 100 ug
$436.00
LY433380 Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 4 100 ug
$436.00
LY433401 Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 2 100 ug
$436.00
TP309484 Recombinant protein of human kelch-like 13 (Drosophila) (KLHL13), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.