PIGL (NM_004278) Human Mass Spec Standard

SKU
PH309339
PIGL MS Standard C13 and N15-labeled recombinant protein (NP_004269)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209339]
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC209339 protein sequence
Red=Cloning site Green=Tags(s)

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW
VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV
LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004269
RefSeq Size 1163
RefSeq ORF 756
Synonyms CHIME
Locus ID 9487
UniProt ID Q9Y2B2
Cytogenetics 17p11.2
Summary This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:PIGL (NM_004278) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418094 PIGL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418094 Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class L (PIGL) 100 ug
$436.00
TP309339 Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.