PIGL (NM_004278) Human Tagged ORF Clone

SKU
RC209339
PIGL (Myc-DDK-tagged)-Human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PIGL
Synonyms CHIME
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209339 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCAATGTGGCTCCTGTGTGTGGCGTTGGCGGTCTTGGCATGGGGCTTCCTCTGGGTTTGGGACT
CCTCAGAACGAATGAAGAGTCGGGAGCAGGGAGGACGGCTGGGAGCCGAAAGCCGGACCCTGCTGGTCAT
AGCGCACCCTGACGATGAAGCCATGTTTTTTGCTCCCACAGTGCTAGGCTTGGCCCGCCTAAGGCACTGG
GTGTACCTGCTTTGCTTCTCTGCAGGAAATTACTACAATCAAGGAGAGACTCGTAAGAAAGAACTTTTGC
AGAGCTGTGATGTTTTGGGGATTCCACTCTCCAGTGTAATGATTATTGACAACAGGGATTTCCCAGATGA
CCCAGGCATGCAGTGGGACACAGAGCACGTGGCCAGAGTCCTCCTTCAGCACATAGAAGTGAATGGCATC
AATCTGGTGGTGACTTTCGATGCAGGGGGAGTAAGTGGCCACAGCAATCACATTGCTCTGTATGCAGCTG
TGAGGGCCCTGCACTCAGAAGGGAAGTTACCTAAAGGGTGCTCTGTGCTCACGCTTCAGTCTGTGAATGT
GCTGCGCAAGTACATCTCCCTTCTGGATCTGCCCTTGTCTCTGCTTCATACGCAGGATGTCCTCTTCGTG
CTCAACAGCAAAGAAGTGGCACAGGCCAAGAAAGCCATGTCCTGCCACCGCAGCCAGCTCCTCTGGTTCC
GCCGCCTCTACATTATCTTCTCCCGGTACATGAGAATCAACTCACTGAGCTTCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209339 protein sequence
Red=Cloning site Green=Tags(s)

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW
VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV
LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004278
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004278.4
RefSeq Size 1163 bp
RefSeq ORF 759 bp
Locus ID 9487
UniProt ID Q9Y2B2
Cytogenetics 17p11.2
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
MW 28.5 kDa
Summary This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PIGL (NM_004278) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209339L3 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL), Myc-DDK-tagged 10 ug
$600.00
RC209339L4 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL), mGFP tagged 10 ug
$600.00
RG209339 PIGL (tGFP-tagged) - Human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL) 10 ug
$500.00
SC111117 PIGL (untagged)-Human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.