RBP7 (NM_052960) Human Mass Spec Standard

SKU
PH309035
RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209035]
Predicted MW 15.5 kDa
Protein Sequence
Protein Sequence
>RC209035 protein sequence
Red=Cloning site Green=Tags(s)

MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE
FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443192
RefSeq Size 704
RefSeq ORF 402
Synonyms CRABP4; CRBP4; CRBPIV
Locus ID 116362
UniProt ID Q96R05
Cytogenetics 1p36.22
Summary The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016]
Write Your Own Review
You're reviewing:RBP7 (NM_052960) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409361 RBP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409361 Transient overexpression lysate of retinol binding protein 7, cellular (RBP7) 100 ug
$436.00
TP309035 Recombinant protein of human retinol binding protein 7, cellular (RBP7), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.