RBP7 (NM_052960) Human Tagged ORF Clone

SKU
RC209035
RBP7 (Myc-DDK-tagged)-Human retinol binding protein 7, cellular (RBP7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RBP7
Synonyms CRABP4; CRBP4; CRBPIV
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGCCGACCTCAGCGGTACTTGGACCCTGCTCAGCAGCGACAACTTCGAGGGCTACATGCTGGCCC
TAGGTATTGACTTTGCCACTCGTAAAATAGCCAAGTTGCTGAAGCCACAGAAAGTGATTGAGCAGAATGG
GGATTCTTTTACCATCCACACGAACAGCAGCCTAAGGAACTACTTTGTGAAATTTAAAGTTGGAGAAGAA
TTTGATGAAGATAACAGAGGCCTGGACAACAGAAAATGCAAGAGTTTGGTTATCTGGGACAATGACAGGC
TCACCTGTATCCAGAAGGGAGAAAAGAAGAACAGAGGCTGGACCCATTGGATCGAAGGAGACAAACTCCA
CCTGGAAATGTTCTGTGAAGGTCAAGTGTGCAAACAGACATTCCAGAGAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209035 protein sequence
Red=Cloning site Green=Tags(s)

MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE
FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_052960
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_052960.3
RefSeq Size 704 bp
RefSeq ORF 405 bp
Locus ID 116362
UniProt ID Q96R05
Cytogenetics 1p36.22
Domains lipocalin
MW 15.5 kDa
Summary The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016]
Write Your Own Review
You're reviewing:RBP7 (NM_052960) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209035L3 Lenti ORF clone of Human retinol binding protein 7, cellular (RBP7), Myc-DDK-tagged 10 ug
$450.00
RC209035L4 Lenti ORF clone of Human retinol binding protein 7, cellular (RBP7), mGFP tagged 10 ug
$450.00
RG209035 RBP7 (tGFP-tagged) - Human retinol binding protein 7, cellular (RBP7) 10 ug
$489.00
SC120177 RBP7 (untagged)-Human retinol binding protein 7, cellular (RBP7) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.