KREMEN1 (NM_001039571) Human Mass Spec Standard

SKU
PH308991
KREMEN1 MS Standard C13 and N15-labeled recombinant protein (NP_001034660)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208991]
Predicted MW 50.18 kDa
Protein Sequence
Protein Sequence
>RC208991 representing NM_001039571
Red=Cloning site Green=Tags(s)

MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNT
LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKT
SNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFD
TLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRV
LARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSV
SAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPG
TSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034660
RefSeq Size 6115
RefSeq ORF 1374
Synonyms FLJ31863; KREMEM1; KREMEN; kringle-coding gene marking the eye and the nose; kringle-containing transmembrane protein 1; kringle containing transmembrane protein 1; KRM1; OTTHUMP00000028977
Locus ID 83999
UniProt ID Q96MU8
Cytogenetics 22q12.1
Summary This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:KREMEN1 (NM_001039571) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422073 KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422074 KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429793 KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422073 Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 3 100 ug
$665.00
LY422074 Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4 100 ug
$436.00
LY429793 Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 2 100 ug
$436.00
TP308991 Recombinant protein of human kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.