C15orf38 (ARPIN) (NM_182616) Human Mass Spec Standard

SKU
PH308793
C15orf38 MS Standard C13 and N15-labeled recombinant protein (NP_872422)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208793]
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC208793 protein sequence
Red=Cloning site Green=Tags(s)

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
EIREQGDGAEDEEWDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872422
RefSeq Size 6114
RefSeq ORF 678
Synonyms C15orf38
Locus ID 348110
UniProt ID Q7Z6K5
Cytogenetics 15q26.1
Summary Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C15orf38 (ARPIN) (NM_182616) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405459 ARPIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405459 Transient overexpression lysate of chromosome 15 open reading frame 38 (C15orf38) 100 ug
$436.00
TP308793 Recombinant protein of human chromosome 15 open reading frame 38 (C15orf38), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.