OLIG3 (NM_175747) Human Mass Spec Standard

SKU
PH308613
OLIG3 MS Standard C13 and N15-labeled recombinant protein (NP_786923)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208613]
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC208613 protein sequence
Red=Cloning site Green=Tags(s)

MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY
KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSS
LEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIR
PPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_786923
RefSeq Size 2196
RefSeq ORF 816
Synonyms Bhlhb7; bHLHe20
Locus ID 167826
UniProt ID Q7RTU3
Cytogenetics 6q23.3
Summary May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:OLIG3 (NM_175747) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406237 OLIG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406237 Transient overexpression lysate of oligodendrocyte transcription factor 3 (OLIG3) 100 ug
$436.00
TP308613 Recombinant protein of human oligodendrocyte transcription factor 3 (OLIG3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.