CTBP1 (NM_001012614) Human Mass Spec Standard

SKU
PH308594
CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012632)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208594]
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC208594 protein sequence
Red=Cloning site Green=Tags(s)

MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITL
TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALR
EGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVS
TLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDV
HESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATH
WASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEA
DRDHASDQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012632
RefSeq Size 2483
RefSeq ORF 1287
Synonyms BARS; HADDTS
Locus ID 1487
UniProt ID Q13363
Cytogenetics 4p16.3
Summary This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Pathways Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway
Write Your Own Review
You're reviewing:CTBP1 (NM_001012614) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310529 CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001319) 10 ug
$3,255.00
LC400528 CTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422883 CTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400528 Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 1 100 ug
$436.00
LY422883 Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 2 100 ug
$436.00
TP308594 Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310529 Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.