GATA2 (NM_032638) Human Mass Spec Standard

SKU
PH308554
GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208554]
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC208554 protein sequence
Red=Cloning site Green=Tags(s)

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV
SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV
YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG
VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP
KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116027
RefSeq Size 3383
RefSeq ORF 1440
Synonyms DCML; IMD21; MONOMAC; NFE1B
Locus ID 2624
UniProt ID P23769
Cytogenetics 3q21.3
Summary This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Write Your Own Review
You're reviewing:GATA2 (NM_032638) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403182 GATA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428960 GATA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403182 Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 2 100 ug
$436.00
LY428960 Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 1 100 ug
$436.00
TP308554 Recombinant protein of human GATA binding protein 2 (GATA2), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.