SKAP55 (SKAP1) (NM_001075099) Human Mass Spec Standard

SKU
PH308493
SKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001068567)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208493]
Predicted MW 41.3 kDa
Protein Sequence
Protein Sequence
>RC208493 protein sequence
Red=Cloning site Green=Tags(s)

MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD
NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF
YYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK
DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD
LEEDESGTRRKGDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLT
TAFEVEER

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001068567
RefSeq Size 1598
RefSeq ORF 1074
Synonyms HEL-S-81p; SCAP1; SKAP55
Locus ID 8631
UniProt ID Q86WV1
Cytogenetics 17q21.32
Summary This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SKAP55 (SKAP1) (NM_001075099) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317083 SKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_003717) 10 ug
$3,255.00
LC401226 SKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421351 SKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401226 Transient overexpression lysate of src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1 100 ug
$436.00
LY421351 Transient overexpression lysate of src kinase associated phosphoprotein 1 (SKAP1), transcript variant 2 100 ug
$436.00
TP308493 Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP317083 Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.