OriGene Logo

SKAP55 (SKAP1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338987
Rabbit Polyclonal Anti-SKAP1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY401226 Transient overexpression lysate of src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1 100 ug
$436.00
TP308493 Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 2, 20 µg
20 ug
$737.00

View other "SKAP55 or NM_003726" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SKAP1 antibody: synthetic peptide directed towards the N terminal of human SKAP1. Synthetic peptide located within the following region: RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name src kinase associated phosphoprotein 1
Database Link
Background This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. provided by RefSeq, Jul 2008
Synonyms HEL-S-81p; SCAP1; SKAP55
Note Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.